Overview

  • Product name

    Recombinant Human ERH protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSHTILLVQPTKRPEGRTYADYESVNE CMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQ TYQPYNKDWIKEKIYVLLRRQAQQAGK
    • Molecular weight

      15 kDa including tags
    • Amino acids

      1 to 104
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104674 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 95 % SDS-PAGE.
    ab104674 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • DROER
    • Enhancer of rudimentary homolog
    • Enhancer of rudimentary homolog (Drosophila)
    • ERH
    • ERH_HUMAN
    • FLJ27340
    • HGNC:3447
    see all
  • Function

    May have a role in the cell cycle.
  • Tissue specificity

    Expressed in all tissues examined.
  • Sequence similarities

    Belongs to the E(R) family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab104674.

References

ab104674 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab104674.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up