Overview

  • Product name

    Recombinant Human ERK-8 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRD KTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMGCPPS PPPPTAVRTLSADTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHV VHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVATRWY RAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILET IPPPSEEDLLALGSGCRASVLHQLGSR
    • Amino acids

      1 to 277
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as MAPK15. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ERK-7
    • ERK-8
    • ERK7
    • ERK8
    • Extracellular regulated kinase 8 delta
    • Extracellular signal regulated kinase 8
    • Extracellular signal-regulated kinase 7
    • Extracellular signal-regulated kinase 8
    • MAP kinase 15
    • MAPK 15
    • Mapk15
    • Mitogen activated protein kinase 15
    • Mitogen-activated protein kinase 15
    • MK15_HUMAN
    see all
  • Function

    In vitro, phosphorylates MBP.
  • Tissue specificity

    Widely expressed with a maximal expression in lung and kidney.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain

    The N-terminal region (1-20) is the minimal region necessary for ubiquitination and further proteasomal degradation.
    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications

    Dually phosphorylated on Thr-175 and Tyr-177, which activates the enzyme. Autophosphorylated on threonine and tyrosine residues in vitro.
    Ubiquitinated. Ubiquitination may allow its tight kinase activity regulation and rapid turnover. May be ubiquitinated by a SCF E3 ligase.
  • Information by UniProt

Images

  • ab153632 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up