Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAQLGAVVAVASSFFCASLFSAVHKIEEGHIGVYYRGGALLTSTSGPGFH LMLPFITSYKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNFLVPNAV YDIVKNYTADYDKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKL ALQQDLTSMAPGLVIQAVRVTKPNIPEAIRRNYELMESEKTKLLIAAQKQ KVVEKEAETERKKALIEAEKVAQVAEITYGQKVMEKETEKKISEIEDAAF LAREKAKADAECYTAMKIAEANKLKLTPEYLQLMKYKAIASNSKIYFGKD IPNMFMDSAGSVSKQFEGLADKLSFGLEDEPLETATKEN
    • Molecular weight

      64 kDa including tags
    • Amino acids

      1 to 339

Specifications

Our Abpromise guarantee covers the use of ab132416 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.

    Previously labelled as SPFH2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C8orf2
    • Chromosome 8 open reading frame 2
    • Endoplasmic reticulum lipid raft associated protein 2
    • Endoplasmic reticulum lipid raft-associated protein 2
    • ER lipid raft associated 2
    • ERLIN 2
    • Erlin-2
    • ERLIN2
    • ERLN2_HUMAN
    • HGNC:1356
    • MGC87072
    • NET32
    • SPFH 2
    • SPFH domain containing protein 2
    • SPFH domain family member 2
    • SPFH domain-containing protein 2
    • SPFH2
    • SPG18
    • Stomatin prohibitin flotillin HflC/K domain containing protein 2
    • Stomatin-prohibitin-flotillin-HflC/K domain-containing protein 2
    see all
  • Function

    Component of the ERLIN1/ERLIN2 complex which mediates the endoplasmic reticulum-associated degradation (ERAD) of inositol 1,4,5-trisphosphate receptors (IP3Rs). Also involved in ITPR1 degradation by the ERAD pathway.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the band 7/mec-2 family.
  • Cellular localization

    Endoplasmic reticulum membrane. Associated with lipid raft-like domains of the endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132416, stained with Coomassie Blue.

References

ab132416 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132416.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up