Overview

  • Product name

    Recombinant Human ERMAP protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      HAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHI FRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQ VGNLSKEDTVILQVAAPSVGSLSPSAVDHHHHHH
    • Molecular weight

      15 kDa including tags
    • Amino acids

      30 to 156
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151911 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Lyophilized from a 0.2 µM filtered solution. Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • ERMAP
    • ERMAP_HUMAN
    • Erythroblast membrane associated protein
    • Erythroid membrane associated protein
    • Erythroid membrane-associated protein
    • hERMAP
    • MGC118810
    • MGC118811
    • MGC118812
    • MGC118813
    • PRO2801
    • Radin blood group (Rd)
    • Radin blood group antigen
    • RD
    • SC
    • Scianna blood group (Sc)
    • Scianna blood group antigen
    see all
  • Function

    Possible role as a cell-adhesion or receptor molecule of erythroid cells.
  • Tissue specificity

    Expressed in erythroid-enriched bone marrow (at protein level). Highly expressed in bone marrow and to a lower extent in leukocytes, thymus, lymph node and spleen.
  • Sequence similarities

    Belongs to the immunoglobulin superfamily. BTN/MOG family.
    Contains 1 B30.2/SPRY domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Developmental stage

    Expressed in fetal liver blood cells (at protein level). Highly expressed in fetal liver.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Cell membrane. Cytoplasm.
  • Information by UniProt

References

This product has been referenced in:

  • Saggese T  et al. GEORG SCHMORL PRIZE OF THE GERMAN SPINE SOCIETY (DWG) 2018: combined inflammatory and mechanical stress weakens the annulus fibrosus: evidences from a loaded bovine AF organ culture. Eur Spine J N/A:N/A (2019). Read more (PubMed: 30689044) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151911.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up