Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSQGVRRAGAGQGVAAAVQLLVTLSFLRSVVEAQVTGVLDDCLCDIDSID NFNTYKIFPKIKKLQERDYFRYYKVNLKRPCPFWAEDGHCSIKDCHVEPC PESKIPVGIKAGHSNKYLKMANNTKELEVCEQANKLGAINSTLSNQSKEA FIDWARYDDSRDHFCELDDERSPAAQYVDLLLNPERYTGYKGTSAWRVWN SIYEENCFKPRSVYRPLNPLAPSRGEDDGESFYTWLEGLCLEKRVFYKLI SGLHASINLHLCANYLLEETWGKPSWGPNIKEFKHRFDPVETKGEGPRRL KNLYFLYLIELRALSKVAPYFERSIVDLYTGNAEEDADTKTLLLNIFQDT KSFPMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWG KLQTQGLGTALKILFSEKEIQKLPENSPSKGFQLTRQEIVALLNAFGRLS TSIRDLQNFKVLLQHSR
    • Molecular weight

      80 kDa including tags
    • Amino acids

      1 to 467

Specifications

Our Abpromise guarantee covers the use of ab132912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Endoplasmic oxidoreductin-1-like protein B
    • Endoplasmic reticulum oxidoreductin-1-like protein B
    • ERO1, S. cerevisiae, homolog of, beta
    • ERO1-L-beta
    • ERO1-like beta (S. cerevisiae)
    • ERO1-like protein beta
    • ERO1B_HUMAN
    • Ero1lb
    • Oxidoreductin-1-L-beta
    see all
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132912, stained with Coomassie Blue.

References

ab132912 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up