Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI PKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKL NMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGV YLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAE QYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTA FQKKGAEKEEL
    • Molecular weight

      55 kDa including tags
    • Amino acids

      1 to 261

Specifications

Our Abpromise guarantee covers the use of ab132070 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C12orf8
    • Chromosome 12 open reading frame 8
    • Endoplasmic reticulum lumenal protein ERp28
    • Endoplasmic reticulum protein 29
    • Endoplasmic reticulum protein 29 isoform 1
    • Endoplasmic reticulum protein ERp29
    • Endoplasmic reticulum resident protein 28
    • Endoplasmic reticulum resident protein 29
    • Endoplasmic reticulum resident protein 31
    • Epididymis secretory protein Li 107
    • ERp28
    • ERP29_HUMAN
    • ERp31
    • HEL S 107
    • PDI-DB
    • PDIA9
    • Protein disulfide isomerase family A member 9
    see all
  • Relevance

    Proper protein folding and post-translational modifications are essential for secretory protein export out of the endoplasmic reticulum. This task is accomplished by chaperone proteins such as protein disulfide isomerase (PDI), GRP94, and BiP. A recently characterized protein, designated ERp29, is closely related to these chaperone proteins and appears to be upregulated during ER stress conditions. ERp29 is a soluble 259-residue protein that is localized to the lumen of the endoplasmic reticulum in all mammalian cells. Research has shown that there are two primary domains within ERp29. The first is the C-terminal region that is a novel, all helical, fold that is most likely involved with ERp29 retention to the ER. The second is the N-terminal region that resembles that of PDI’s thioredoxin module. The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER.
  • Cellular localization

    Endoplasmic reticulum, Cell surface.

Images

  • 12.5% SDS-PAGE analysis of ab132070, stained with Coomassie Blue.

References

ab132070 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132070.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up