Description

  • Product name

    Recombinant human ERp72 protein
    See all ERp72 proteins and peptides
  • Biological activity

    Specific activity > 10 A650/cm/min/mg. Enzymatic activity was confirmed by measuring the aggregation of insulin in the presence of DTT.

  • Purity

    > 90 % SDS-PAGE.
    ab206794 was expressed in E.coli and purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMVAGAEGPDEDSSNRENAIEDEEEEEEEDD DEEEDDLEVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAP EYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAV DYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILV EFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDV SGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEF LKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLK VSQGQLVVMQPEKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGH RKVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYT FAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLR EFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKDVLIE FYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEG FPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
    • Predicted molecular weight

      73 kDa including tags
    • Amino acids

      21 to 645
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_004902. Mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab206794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    Functional Studies

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 0.02% DTT, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Calcium binding protein intestinal related
    • Endoplasmic reticulum resident protein 70
    • Endoplasmic reticulum resident protein 72
    • EPR70
    • EPR72
    • ER protein 70
    • ER protein 72
    • ERP 70
    • ERp 72
    • ERp-72
    • ERp70
    • ERp72
    • PDIA 4
    • Pdia4
    • PDIA4_HUMAN
    • PDIR
    • Protein disulfide isomerase A4
    • Protein disulfide isomerase associated 4
    • Protein disulfide isomerase family A member 4
    • Protein disulfide isomerase related protein
    • protein disulfide isomerase related protein (calcium-binding protein, intestinal-related)
    • Protein disulfide-isomerase A4
    • Protein ERp 72
    • Protein ERp72
    see all
  • Sequence similarities

    Belongs to the protein disulfide isomerase family.
    Contains 3 thioredoxin domains.
  • Cellular localization

    Endoplasmic reticulum lumen. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab206794 (3 µg).

References

ab206794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up