Description

  • Product name

    Recombinant human Estrogen Inducible Protein pS2
    See all Estrogen Inducible Protein pS2 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard.

    Determined by its ability to activate ERK1/2 (a MAPkinase signaling molecule) using a concentration 1.0-2.0 μg/ml.

  • Purity

    > 97 % SDS-PAGE.
    > 97 % by HPLC analysis.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTI DVPPEEECEF
    • Predicted molecular weight

      13 kDa
    • Amino acids

      25 to 84
    • Additional sequence information

      Homodimeric protein consisting of two 60 amino acid polypeptide chains, which includes a 40-amino acid trefoil motif containing three conserved intramolecular disulfide bonds.

Specifications

Our Abpromise guarantee covers the use of ab201359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    This product is the mature full length protein from aa 25 to 84. The signal peptide is not included.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    Lyophilized from a 0.2µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • BCEI
    • Breast cancer estrogen inducible protein
    • Breast cancer estrogen inducible sequence
    • Breast cancer estrogen-inducible protein
    • D21S21
    • Gastrointestinal trefoil protein
    • Gastrointestinal trefoil protein pS2
    • hP1.A
    • HP1A
    • HPS 2
    • HPS2
    • pNR 2
    • PNR-2
    • pNR2
    • Polypeptide P1.A
    • Protein pS2
    • PS 2
    • pS2
    • pS2 protein
    • TFF 1
    • TFF1
    • TFF1_HUMAN
    • Trefoil factor 1
    see all
  • Function

    Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.
  • Tissue specificity

    Found in stomach, with highest levels in the upper gastric mucosal cells (at protein level). Detected in goblet cells of the small and large intestine and rectum, small submucosal glands in the esophagus, mucous acini of the sublingual gland, submucosal glands of the trachea, and epithelial cells lining the exocrine pancreatic ducts but not in the remainder of the pancreas (at protein level). Scattered expression is detected in the epithelial cells of the gallbladder and submucosal glands of the vagina, and weak expression is observed in the bronchial goblet cells of the pseudostratified epithelia in the respiratory system (at protein level). Detected in urine (at protein level). Strongly expressed in breast cancer but at low levels in normal mammary tissue. It is regulated by estrogen in MCF-7 cells. Strong expression found in normal gastric mucosa and in the regenerative tissues surrounding ulcerous lesions of gastrointestinal tract, but lower expression found in gastric cancer (at protein level).
  • Sequence similarities

    Contains 1 P-type (trefoil) domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab201359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up