Description

  • Product name

    Recombinant Human Estrogen Receptor alpha protein
    See all Estrogen Receptor alpha proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab153776 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from an 0.2 µM filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPA VYNYPEGAAYEFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPL NSVSPSPLMLLHPPPQ
    • Predicted molecular weight

      12 kDa
    • Amino acids

      1 to 116
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Dissolve the lyophilized protein in 1X PBS.
    Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • 7*/654 isoform
    • 7*/819 2 isoform
    • 7*/822 isoform
    • 8*/901 isoform
    • 8*/941 isoform
    • DKFZp686N23123
    • ER
    • ER alpha
    • ER-alpha
    • Era
    • ESR
    • ESR1
    • ESR1_HUMAN
    • ESRA
    • Estradiol receptor
    • Estrogen nuclear receptor alpha
    • Estrogen receptor
    • Estrogen receptor 1
    • Estrogen receptor alpha
    • Estrogen receptor alpha 3*,4,5,6,7*/822 isoform
    • Estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform
    • Estrogen receptor alpha delta 3*,4,5,6,7*/819 2 isoform
    • Estrogen receptor alpha delta 4 +49 isoform
    • Estrogen receptor alpha delta 4*,5,6,7*/654 isoform
    • Estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform
    • Estrogen receptor alpha E1 E2 1 2
    • Estrogen receptor alpha E1 N2 E2 1 2
    • ESTRR
    • NR3A1
    • Nuclear receptor subfamily 3 group A member 1
    see all
  • Function

    Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Can activate the transcriptional activity of TFF1.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR3 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Domain

    Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
  • Post-translational
    modifications

    Phosphorylated by cyclin A/CDK2. Phosphorylation probably enhances transcriptional activity.
    Glycosylated; contains N-acetylglucosamine, probably O-linked.
    Ubiquitinated. Deubiquitinated by OTUB1.
    Dimethylated by PRMT1 at Arg-260. The methylation may favor cytoplasmic localization.
    Palmitoylated (isoform 3). Not biotinylated (isoform 3).
  • Cellular localization

    Nucleus. Cytoplasm. Cell membrane. A minor fraction is associated with the inner membrane and Nucleus. Cytoplasm. Cell membrane. Associated with the inner membrane via palmitoylation.
  • Information by UniProt

References

This product has been referenced in:

  • Yin JJ  et al. Controllable drug uptake and nongenomic response through estrogen-anchored cyclodextrin drug complex. Int J Nanomedicine 10:4717-30 (2015). Read more (PubMed: 26251594) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up