Description

  • Product name

    Recombinant Human ETFB protein
  • Purity

    > 90 % SDS-PAGE.
    ab107152 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAELRVLVAVKRVIDYAVKIRVKPDRTGVV TDGVKHSMNPFCEIAVEEAVRLKEKKLVKEVIAVSCGPAQCQETIRTALA MGADRGIHVEVPPAEAERLGPLQVARVLAKLAEKEKVDLVLLGKQAIDDD CNQTGQMTAGFLDWPQGTFASQVTLEGDKLKVEREIDGGLETLRLKLPAV VTADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDP PQRTAGVKVETTEDLVAKLKEIGRI
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      1 to 255
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107152 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.316% Tris HCl, 40% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Beta ETF
    • Beta-ETF
    • Electron transfer flavoprotein beta polypeptide
    • Electron transfer flavoprotein beta subunit
    • Electron transfer flavoprotein subunit beta
    • Electron transferring flavoprotein beta polypeptide
    • etfB
    • ETFB_HUMAN
    • FP585
    • MADD
    see all
  • Function

    The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).
  • Tissue specificity

    Abundant in liver, heart and skeletal muscle. A weak expression is seen in the brain, placenta, lung, kidney and pancreas.
  • Involvement in disease

    Glutaric aciduria 2B
  • Sequence similarities

    Belongs to the ETF beta-subunit/FixA family.
  • Domain

    The recognition loop recognizes a hydrophobic patch at the surface of interacting dehydrogenases and acts as a static anchor at the interface.
  • Post-translational
    modifications

    Methylated. Trimethylation at Lys-200 and Lys-203 may negatively regulate the activity in electron transfer from Acyl-CoA dehydrogenases.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107152 (3µg).

References

ab107152 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us.

Both ab91685 and ab107152 are provided in denatured condition which does not needed to be refolded (renaturation).

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up