Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLVPLAKLSCLAYQCFHALKIKKNYLPLCAIRWSSTSTVPRITTHYTIYP RDKDKRWEGVNMERFAEEADVVIVGAGPAGLSAAVRLKQLAVAHEKDIRV CLVEKAAQIGAHTLSGACLDPGAFKELFPDWKEKGAPLNTPVTEDRFGIL TEKYRIPVPILPGLPMNNHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAA AEVLFHDDGSVKGIATNDVGIQKDGAPKATFERGLELHAKVTIFAEGCHG HLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKNWKPGRVDHTVGWPLD RHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIR PTLEGGKRIAYGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGT HTAMKSGILAAESIFNQLTSENLQSKTIGLHVTEYEDNLKNSWVWKELYS VRNIRPSCHGVLGVYGGMIYTGIFYWILRGMEPWTLKHKGSDFERLKPAK DCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLRDDSIPVNRNL SIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQN INWVVPEGGGGPAYNGM
    • Molecular weight

      95 kDa including tags
    • Amino acids

      1 to 617

Specifications

Our Abpromise guarantee covers the use of ab132895 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Electron transfer flavoprotein ubiquinone oxidoreductase
    • Electron transfer flavoprotein-ubiquinone oxidoreductase
    • electron transferring flavoprotein dehydrogenase
    • Electron-transferring-flavoprotein dehydrogenase
    • ETF dehydrogenase
    • ETF QO
    • ETF ubiquinone oxidoreductase
    • ETF-QO
    • ETF-ubiquinone oxidoreductase
    • ETFD_HUMAN
    • Etfdh
    • MADD
    • mitochondrial
    see all
  • Function

    Accepts electrons from ETF and reduces ubiquinone.
  • Involvement in disease

    Defects in ETFDH are the cause of glutaric aciduria type 2C (GA2C) [MIM:231680]. GA2C is an autosomal recessively inherited disorder of fatty acid, amino acid, and choline metabolism. It is characterized by multiple acyl-CoA dehydrogenase deficiencies resulting in large excretion not only of glutaric acid, but also of lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids.
  • Sequence similarities

    Belongs to the ETF-QO/fixC family.
    Contains 1 4Fe-4S ferredoxin-type domain.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132895 stained with Coomassie Blue.

References

ab132895 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132895.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up