Description

  • Product name

    Recombinant Human ETS1 protein
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab172853 is 0.2 µM filtered.
  • Endotoxin level

    1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMKAAVDLKPTLTIIKTEKVDLELFPSPDME CADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDW VMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLE ILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEV VTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      1 to 272
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.03% EDTA, 99% PBS

General Info

  • Alternative names

    • Avian erythroblastosis virus E26 (v ets) oncogene homolog 1
    • C ets 1 protein
    • c-ets-1
    • ETS 1
    • Ets protein
    • ETS proto-oncogene 1, transcription factor
    • ETS1
    • ETS1 oncogene
    • ETS1 protein
    • ETS1_HUMAN
    • EWSR 2
    • EWSR2
    • FLJ10768
    • Oncogene ETS1
    • P54
    • Protein C-ets-1
    • v ets avian erythroblastosis virus E2 oncogene homolog
    • v ets avian erythroblastosis virus E2 oncogene homolog 1
    • v ets avian erythroblastosis virus E26 oncogene homolog 1
    • v ets erythroblastosis virus E26 oncogene homolog 1
    • v-ets erythroblastosis virus E26 oncogene homolog 1
    see all
  • Function

    Transcription factor.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Post-translational
    modifications

    Sumoylated on Lys-15 and Lys-227, preferentially by SUMO2; which inhibits transcriptional activity.
    Ubiquitinated; which induces proteasomal degradation.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab172853 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172853.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up