Description

  • Product name

    Recombinant Human EVA1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MYGKSSTRAVLLLLGIQLTALWPIAAVEIYTSRVLEAVNGTDARLKCTFS SFAPVGDALTVTWNFRPLDGGPEQFVFYYHIDPFQPMSGRFKDRVSWDGN PERYDASILLWKLQFDDNGTYTCQVKNPPDVDGVIGEIRLSVVHTVRFSE IHFLALAIGSACALMIIIVIVVVLFQHYRKKRWAERAHKVVEIKSKEEER LNQEKKVSVYLEDTD
    • Amino acids

      1 to 215
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Epithelial V like antigen 1
    • EVA
    • EVA1
    • MPZL2
    • MPZL2 myelin protein zero like 2
    • Myelin protein zero like 2
    • Myelin protein zero like protein 2
    see all
  • Relevance

    Epithelial V-like antigen (EVA) is expressed in thymus epithelium and strongly downregulated by thymocyte developmental progression. EVA1 is expressed in the thymus and in several epithelial structures early in embryogenesis. It is highly homologous to the myelin protein zero and is poorly soluble in nonionic detergents, strongly suggesting an association to the cytoskeleton. Its capacity to mediate cell adhesion through a homophilic interaction and its selective regulation by T cell maturation might imply the participation of EVA in the earliest phases of thymus organogenesis. The protein bears a characteristic V-type domain and two potential N-glycosylation sites in the extracellular domain; a putative serine phosphorylation site for casein kinase 2 is also present in the cytoplasmic tail. EVA1 expression is elevated in some T-cell leukemias. There are two isoforms.
  • Cellular localization

    Cell Membrane; Single-pass type I membrane protein, cytoskeleton

Images

  • ab160877 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up