Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGALRPTLLPPSLPLLLLLMLGMGCWAREVLVPEGPLYRVAGTAVSISCN VTGYEGPAQQNFEWFLYRPEAPDTALGIVSTKDTQFSYAVFKSRVVAGEV QVQRLQGDAVVLKIARLQAQDAGIYECHTPSTDTRYLGSYSGKVELRVLP DVLQVSAAPPGPRGRQAPTSPPRMTVHEGQELALGCLARTSTQKHTHLAV SFGRSVPEAPVGRSTLQEVVGIRSDLAVEAGAPYAERLAAGELRLGKEGT DRYRMVVGGAQAGDAGTYHCTAAEWIQDPDGSWAQIAEKRAVLAHVDVQT LSSQLAVTVGPGERRIGPGEPLELLCNVSGALPPAGRHAAYSVGWEMAPA GAPGPGRLVAQLDTEGVGSLGPGYEGRHIAMEKVASRTYRLRLEAARPGD AGTYRCLAKAYVRGSGTRLREAASARSRPLPVHVREEGVVLEAVAWLAGG TVYRGETASLLCNISVRGGPPGLRLAASWWVERPEDGELSSVPAQLVGGV GQDGVAELGVRPGGGPVSVELVGPRSHRLRLHSLGPEDEGVYHCAPSAWV QHADYSWYQAGSARSGPVTVYPYMHALDTLFVPLLVGTGVALVTGATVLG TITCCFMKRLRKR
    • Molecular weight

      91 kDa including tags
    • Amino acids

      1 to 613

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132826 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD316
    • CD316 antigen
    • CD81 partner 3
    • CD81P3
    • EWI-2
    • EWI2
    • Glu-Trp-Ile EWI motif-containing protein 2
    • igsf-8
    • IgSF8
    • IGSF8_HUMAN
    • Immunoglobulin superfamily member 8
    • Immunoglobulin superfamily member 8 precursor
    • KCT-4
    • KCT4
    • Keratinocytes-associated transmembrane protein 4
    • LIR-D1
    • PGRL
    • Prostaglandin regulatory-like protein
    see all
  • Function

    May play a key role in diverse functions ascribed to CD81 and CD9 such as oocytes fertilization or hepatitis C virus function. May regulate proliferation and differentiation of keratinocytes. May be a negative regulator of cell motility: suppresses T-cell mobility coordinately with CD81, associates with CD82 to suppress prostate cancer cell migration, regulates epidermoid cell reaggregation and motility on laminin-5 with CD9 and CD81 as key linkers. May also play a role on integrin-dependent morphology and motility functions. May participate in the regulation of neurite outgrowth and maintenance of the neural network in the adult brain.
  • Tissue specificity

    Expressed in brain, kidney, testis, liver and placenta with moderate expression in all other tissues. Detected on a majority of B-cells, T-cells, and natural killer cells but not on monocytes, polynuclear cells and platelets.
  • Sequence similarities

    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain

    The Ig-like C2-type domains 3 and 4 are required for interaction with CD81.
    The short cytoplasmic domain is very basic, interacts with membrane PIPs, and mediates plasma membrane localization.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132826 stained with Coomassie Blue.

References

ab132826 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132826.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up