Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVE RPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVY WVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGAT KRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLF KVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLIL ANILEACEHMTSDQRKQIFSRLAES
    • Amino acids
      1 to 275
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162388 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA3J10.7
    • CGI 102
    • CGI-102
    • Exosome complex component RRP40
    • Exosome complex exonuclease RRP40
    • Exosome component 3
    • hRrp 40
    • hRrp-40
    • hRrp40
    • hRrp40p
    • p10
    • PCH1B
    • Ribosomal RNA processing protein 40
    • Ribosomal RNA-processing protein 40, S. cerevisiae, homolog of
    • RP11-3J10.8
    • RRP 40
    • Rrp40
    • Rrp40p
    see all
  • Relevance
    EXOSC3 is a component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions. It is required for the 3'processing of the 7S pre-RNA to the mature 5.8S rRNA. Has a 3'-5' exonuclease activity. [Swiss-Prot]
  • Cellular localization
    Cytoplasm. Nucleus, nucleolus.

Images

  • ab162388 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162388 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162388.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up