Recombinant Human EXOSC4 protein (ab162764)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALA VVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMG LQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAG IPMRDFVCACSAGFVDGTALADLSHVEEAAGGPQLALALLPASGQIALLE MDARLHEDHLERVLEAAAQAARDVHTLLDRVVRQHVREASILLGD
    • Amino acids
      1 to 245
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162764 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EXOSC 4
    • Exosome complex component RRP41
    • Exosome complex exonuclease RRP41
    • Exosome component 4
    • Exosome component Rrp41
    • FLJ20591
    • hRrp41p
    • p12A
    • Ribosomal RNA processing protein 41
    • RRP 41
    • RRP41
    • RRP41A
    • Rrp41p
    • SKI 6
    • SKI6
    • Ski6p
    see all
  • Relevance
    EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.
  • Cellular localization
    Cytoplasm. Nucleus, nucleolus.

Images

  • ab162764 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162764 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162764.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up