Recombinant Human EXOSC8 protein (ab180278)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, MS
Description
-
Product name
Recombinant Human EXOSC8 protein -
Purity
> 90 % SDS-PAGE.
ab180278 is purified using conventional chromatography. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAAGFKTVEPLEYYRRFLKENCRPDGR ELGEFRTTTVNIGSISTADGSALVKLGNTTVICGVKAEFAAPSTDAPDKG YVVPNVDLPPLCSSRFRSGPPGEEAQVASQFIADVIENSQIIQKEDLCIS PGKLVWVLYCDLICLDYDGNILDACTFALLAALKNVQLPEVTINEETALA EVNLKKKSYLNIRTHPVATSFAVFDDTLLIVDPTGEEEHLATGTLTIVMD EEGKLCCLHKPGGSGLTGAKLQDCMSRAVTRHKEVKKLMDEVIKSMKPK -
Predicted molecular weight
32 kDa including tags -
Amino acids
1 to 276 -
Tags
His tag N-Terminus -
Additional sequence information
NP_852480.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab180278 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Mass Spectrometry
-
Mass spectrometry
MALDI-TOF -
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 8.00
Constituents: 0.32% Tris HCl, 50% Glycerol (glycerin, glycerine), 1.17% Sodium chloride, 0.02% DTT
General Info
-
Alternative names
- bA421P11.3
- CBP interacting protein 3
- CIP3
see all -
Function
Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC8 binds to ARE-containing RNAs. -
Sequence similarities
Belongs to the RNase PH family. -
Cellular localization
Cytoplasm. Nucleus. Nucleus > nucleolus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab180278 has not yet been referenced specifically in any publications.