Description

  • Product name

    Recombinant Human EXTL1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      AQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMVAEASPTVDSF RPGFDVALPFLPEAHPLRGGAPGQLRQHSPQPGVALLALEEERGGWRTAD T
    • Amino acids

      141 to 241
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158397 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Alpha N acetylglucosaminyltransferase II
    • Exostoses (multiple) like 1
    • Exostosin like glycosyltransferase 1
    • Exostosin-L
    • Exostosin-like 1
    • EXTL
    • Extl1
    • EXTL1_HUMAN
    • Glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
    • Glucuronyl N acetylglucosaminylproteoglycan alpha 1,4 N acetylglucosaminyltransferase
    • MGC70794
    • Multiple exostosis-like protein
    see all
  • Function

    Probable glycosyltransferase.
  • Pathway

    Protein modification; protein glycosylation.
  • Sequence similarities

    Belongs to the glycosyltransferase 47 family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab158397 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158397 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158397.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up