Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHY QAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQ VFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTS SGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHAL IDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHR AEHALQRSYCINKLVNIYDSMPLRYSNITISQFGFPYANYKRKI
    • Molecular weight

      58 kDa
    • Amino acids

      39 to 330

Specifications

Our Abpromise guarantee covers the use of ab132728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 4-N-acetylhexosaminyltransferase EXTL2
    • Alpha 1
    • Alpha 1 4 N acetylhexosaminyltransferase EXTL2
    • Alpha GalNAcT EXTL2
    • Alpha-1
    • Alpha-GalNAcT EXTL2
    • Exostoses (multiple) like 2
    • Exostoses multiple like 2
    • Exostosin like 2
    • Exostosin like glycosyltransferase 2
    • EXT L2
    • EXT related protein 2
    • EXT-related protein 2
    • EXTL 2
    • EXTL2
    • EXTL2_HUMAN
    • EXTR 2
    • EXTR2
    • Glucuronyl galactosyl proteoglycan 4 alpha N acetylglucosaminyltransferase
    • Glucuronyl-galactosyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase
    • Multiple exostoses like 2
    • Processed exostosin like 2
    • Processed exostosin-like 2
    see all
  • Function

    Glycosyltransferase required for the biosynthesis of heparan-sulfate and responsible for the alternating addition of beta-1-4-linked glucuronic acid (GlcA) and alpha-1-4-linked N-acetylglucosamine (GlcNAc) units to nascent heparan sulfate chains.
  • Tissue specificity

    Ubiquitous.
  • Pathway

    Glycan metabolism; heparan sulfate biosynthesis.
  • Sequence similarities

    Belongs to the glycosyltransferase 47 family.
  • Post-translational
    modifications

    The soluble form derives from the membrane form by proteolytic processing.
  • Cellular localization

    Endoplasmic reticulum membrane and Secreted. A soluble form is found in the serum.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132728 stained with Coomassie Blue.

References

ab132728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up