Description

  • Product name

    Recombinant Human EYS protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HVVVIQNQTLIKAYINNSLILSEDIDPHKNFVALNYDGICYLGGFEYGRK VNIVTQEIFKTNFVGKIKDVVFFQEPKNIELIKLEGYNVYDGDEQNEVT
    • Amino acids

      309 to 407
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166318 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • bA166P24.2
    • bA307F22.3
    • bA74E24.1
    • C6orf178
    • C6orf179
    • C6orf180
    • dJ1018A4.2
    • dJ22I17.2
    • dJ303F19.1
    • EGF-like protein 10
    • EGF-like protein 11
    • EGF-like-domain, multiple 10
    • EGF-like-domain, multiple 11
    • EGFL10
    • EGFL11
    • Epidermal growth factor-like protein 10
    • Epidermal growth factor-like protein 11
    • Eyes shut homolog (Drosophila)
    • EYS
    • EYS_HUMAN
    • KIAA0663
    • OTTHUMP00000016688
    • OTTHUMP00000179129
    • OTTHUMP00000213100
    • OTTHUMP00000217891
    • Protein eyes shut homolog
    • Protein spacemaker homolog
    • RP25
    • SPAM
    see all
  • Function

    Required to maintain the integrity of photoreceptor cells.
  • Tissue specificity

    Present in retina.
  • Involvement in disease

    Defects in EYS are the cause of retinitis pigmentosa type 25 (RP25) [MIM:602772]. RP leads to degeneration of retinal photoreceptor cells. Patients suffer from night blindness, beginning at approximately 25 years of age, and deterioration of visual acuity (central vision), beginning at approximately 30 years of age. By age 55 to 60 years, many affected subjects have no perception of light in either eye.
  • Sequence similarities

    Belongs to the EYS family.
    Contains 27 EGF-like domains.
    Contains 5 laminin G-like domains.
  • Cellular localization

    Secreted. Localizes in the photoreceptor cell layer.
  • Information by UniProt

Images

  • ab166318 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166318 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166318.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up