Recombinant Human EZH2 + EED + SUZ12 + AEBP2 + RBBP4 (mutated Y646 H) protein (ab198082)

Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence 1
    • Accession
    • Species

      Human
    • Sequence

      GQTGKKSEK GPVCWRKRVK SEYMRLRQLK RFRRADEVKS MFSSNRQKIL ERTEILNQEW KQRRIQPVHI LTSVSSLRGT RECSVTSDLD FPTQVIPLKT LNAVASVPIM YSWSPLQQNF MVEDETVLHN IPYMGDEVLD QDGTFIEELI KNYDGKVHGD RECGFINDEI FVELVNALGQ YNDDDDDDDG DDPEEREEKQ KDLEDHRDDK ESRPPRKFPS DKIFEAISSM FPDKGTAEEL KEKYKELTEQ QLPGALPPEC TPNIDGPNAK SVQREQSLHS FHTLFCRRCF KYDCFLHRKC NYSFHATPNT YKRKNTETAL DNKPCGPQCY QHLEGAKEFA AALTAERIKT PPKRPGGRRR GRLPNNSSRP STPTINVLES KDTDSDREAG TETGGENNDK EEEEKKDETS SSSEANSRCQ TPIKMKPNIE PPENVEWSGA EASMFRVLIG TYYDNFCAIA RLIGTKTCRQ VYEFRVKESS IIAPAPAEDV DTPPRKKKRK HRLWAAHCRK IQLKKDGSSN HVYNYQPCDH PRQPCDSSCP CVIAQNFCEK FCQCSSECQN RFPGCRCKAQ CNTKQCPCYL AVRECDPDLC LTCGAADHWD SKNVSCKNCS IQRGSKKHLL LAPSDVAGWG IFIKDPVQKN EFISEHCGEI ISQDEADRRG KVYDKYMCSF LFNLNNDFVV DATRKGNKIR FANHSVNPNC YAKVMMVNGD HRIGIFAKRA IQTGEELFFD YRYSQADALK YVGIEREMEI P
    • Molecular weight

      86 kDa including tags
    • Amino acids

      2 to 751
    • Modifications

      mutated Y646 H
    • Tags

      His tag N-Terminus
    • Additional sequence information

      EZH2 (NM_004456)
    Amino Acid Sequence 2
    • Accession
    • Species

      Human
    • Sequence

      SEREVSTAPAGTDMPAAKKQKLSSDENSNPDLSGDENDDAVSIESGTNTE RPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKCVNSLKEDHNQPLFGVQF NWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCA WTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPR DPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKI MSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFST RDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVT ILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKC TTLTHHKCGAAIRQTSFSRD SSILIAVCDDASIWRWDRLR
    • Molecular weight

      51 kDa including tags
    • Amino acids

      2 to 441
    • Tags

      DDDDK tag N-Terminus
    • Additional sequence information

      EED (NM_003797)
    Amino Acid Sequence 3
    • Accession
    • Species

      Human
    • Sequence

      APQKHGGGG GGGSGPSAGS GGGGFGGSAA VAAATASGGK SGGGSCGGGG SYSASSSSSA AAAAGAAVLP VKKPKMEHVQ ADHELFLQAF EKPTQIYRFL RTRNLIAPIF LHRTLTYMSH RNSRTNIKRK TFKVDDMLSK VEKMKGEQES HSLSAHLQLT FTGFFHKNDK PSPNSENEQN SVTLEVLLVK VCHKKRKDVS CPIRQVPTGK KQVPLNPDLN QTKPGNFPSL AVSSNEFEPS NSHMVKSYSL LFRVTRPGRR EFNGMINGET NENIDVNEEL PARRKRNRED GEKTFVAQMT VFDKNRRLQL LDGEYEVAMQ EMEECPISKK RATWETILDG KRLPPFETFS QGPTLQFTLR WTGETNDKST APIAKPLATR NSESLHQENK PGSVKPTQTI AVKESLTTDL QTRKEKDTPN ENRQKLRIFY QFLYNNNTRQ QTEARDDLHC PWCTLNCRKL YSLLKHLKLC HSRFIFNYVY HPKGARIDVS INECYDGSYA GNPQDIHRQP GFAFSRNGPV KRTPITHILV CRPKRTKASM SEFLESEDGE VEQQRTYSSG HNRLYFHSDT CLPLRPQEME VDSEDEKDPE WLREKTITQI EEFSDVNEGE KEVMKLWNLH VMKHGFIADN QMNHACMLFV ENYGQKIIKK NLCRNFMLHL VSMHDFNLIS IMSIDKAVTK LREMQQKLEK GESASPANEE ITEEQNGTAN GFSEINSKEK ALETDSVSGV SKQSKKQKL
    • Molecular weight

      87 kDa including tags
    • Amino acids

      2 to 739
    • Tags

      His tag N-Terminus
    • Additional sequence information

      SUZ12 (NM_015355).
    Amino Acid Sequence 4
    • Accession
    • Species

      Human
    • Sequence

      AAAITDMAD LEELSRLSPL PPGSPGSAAR GRAEPPEEEE EEEEEEEEAE AEAVAALLLN GGSGGGGGGG GGGVGGGEAE TMSEPSPESA SQAGEDEDEE EDDEEEEDES SSSGGGEEES SAESLVGSSG GSSSDETRSL SPGAASSSSG DGDGKEGLEE PKGPRGSQGG GGGGSSSSSV VSSGGDEGYG TGGGGSSATS GGRRGSLEMS SDGEPLSRMD SEDSISSTIM DVDSTISSGR STPAMMNGQG STTSSSKNIA YNCCWDQCQA CFNSSPDLAD HIRSIHVDGQ RGGVFVCLWK GCKVYNTPST SQSWLQRHML THSGDKPFKC VVGGCNASFA SQGGLARHVP THFSQQNSSK VSSQPKAKEE SPSKAGMNKR RKLKNKRRRS LPRPHDFFDA QTLDAIRHRA ICFNLSAHIE SLGKGHSVVF HSTVIAKRKE DSGKIKLLLH WMPEDILPDV WVNESERHQL KTKVVHLSKL PKDTALLLDP NIYRTMPQKR LKR
    • Molecular weight

      53 kDa including tags
    • Amino acids

      2 to 503
    • Tags

      His tag N-Terminus
    • Additional sequence information

      AEBP2 (NM_153207)
    Amino Acid Sequence 5
    • Accession
    • Species

      Human
    • Sequence

      ADKEAAFDD AVEERVINEE YKIWKKNTPF LYDLVMTHAL EWPSLTAQWL PDVTRPEGKD FSIHRLVLGT HTSDEQNHLV IASVQLPNDD AQFDASHYDS EKGEFGGFGS VSGKIEIEIK INHEGEVNRA RYMPQNPCII ATKTPSSDVL VFDYTKHPSK PDPSGECNPD LRLRGHQKEG YGLSWNPNLS GHLLSASDDH TICLWDISAV PKEGKVVDAK TIFTGHTAVV EDVSWHLLHE SLFGSVADDQ KLMIWDTRSN NTSKPSHSVD AHTAEVNCLS FNPYSEFILA TGSADKTVAL WDLRNLKLKL HSFESHKDEI FQVQWSPHNE TILASSGTDR RLNVWDLSKI GEEQSPEDAE DGPPELLFIH GGHTAKISDF SWNPNEPWVI CSVSEDNIMQ VWQMAENIYN DEDPEGSVDP EGQGS
    • Molecular weight

      48 kDa including tags
    • Amino acids

      2 to 425
    • Tags

      His tag N-Terminus
    • Additional sequence information

      RBBP4 (NM_005610)

Specifications

Our Abpromise guarantee covers the use of ab198082 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.36% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

General Info

  • Alternative names

    • Adipocyte enhancer-binding protein 2
    • AE-binding protein 2
    • CAF-1 subunit C
    • CAF-I 48 kDa subunit
    • CAF-I p48
    • ChET 9 protein
    • CHET9
    • Chromatin assembly factor 1 subunit C
    • Chromatin assembly factor I p48 subunit
    • Chromatin precipitated E2F target 9 protein
    • EC=2.1.1.43
    • embryonic ectoderm development
    • Enhancer of zeste homolog 2
    • ENX-1
    • ENX1
    • EZH1
    • hEED
    • Histone-binding protein RBBP4
    • Histone-lysine N-methyltransferase EZH2
    • JJAZ1
    • Joined to JAZF1 protein
    • KIAA0160
    • KMT6
    • KMT6A
    • Lysine N-methyltransferase 6
    • MSI1 protein homolog
    • Nucleosome-remodeling factor subunit RBAP48
    • Polycomb protein EED
    • Polycomb protein SUZ12
    • RBAP48
    • Retinoblastoma-binding protein 4
    • Retinoblastoma-binding protein p48
    • Suppressor of zeste 12 protein homolog
    • WAIT-1
    • WD protein associating with integrin cytoplasmic tails 1
    • WVS2
    • Zinc finger protein AEBP2
    see all
  • Relevance

    EED: Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A. RBBP4: Core histone-binding subunit that may target chromatin assembly factors, chromatin remodeling factors and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the chromatin assembly factor 1 (CAF-1) complex, which is required for chromatin assembly following DNA replication and DNA repair; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex. SUZ12: Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A. EZH2: Polycomb group (PcG) protein. Catalytic subunit of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' (H3K9me) and 'Lys-27' (H3K27me) of histone H3, leading to transcriptional repression of the affected target gene. Able to mono-, di- and trimethylate 'Lys-27' of histone H3 to form H3K27me1, H3K27me2 and H3K27me3, respectively. Compared to EZH2-containing complexes, it is more abundant in embryonic stem cells and plays a major role in forming H3K27me3, which is required for embryonic stem cell identity and proper differentiation. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1, CDKN2A and retinoic acid target genes. EZH2 can also methylate non-histone proteins such as the transcription factor GATA4. AEBP2: DNA-binding transcriptional repressor. May interact with and stimulate the activity of the PRC2 complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3.
  • Cellular localization

    Chromosome Nucleus

Images

  • 10% gradient SDS-PAGE analysis of ab198082 (4 μg).

References

ab198082 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198082.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up