Recombinant Human EZH2 + SUZ12 + RbAp48 protein (ab198127)

Overview

  • Product name

    Recombinant Human EZH2 + SUZ12 + RbAp48 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence 1
    • Accession
    • Species

      Human
    • Sequence

      GQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILE RTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTL NAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIK NYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQK DLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQ LPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHRKCN YSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTP PKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKE EEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEWSGAEASMFRVLIGT YYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDVDTPPRKKKRKH RLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKF CQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDS KNVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEII SQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCY AKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP
    • Molecular weight

      114 kDa including tags
    • Amino acids

      2 to 751
    • Tags

      His tag N-Terminus , GST tag N-Terminus
    • Additional sequence information

      NM_004456.
    Amino Acid Sequence 2
    • Accession
    • Species

      Human
    • Sequence

      ADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLP DVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSE KGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLV FDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHT ICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQK LMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALW DLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIG EEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQV WQMAENIYNDEDPEGSVDPEGQGS
    • Molecular weight

      48 kDa including tags
    • Amino acids

      2 to 425
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NM_005610.
    Amino Acid Sequence 3
    • Accession
    • Species

      Human
    • Sequence

      MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGG SYSASSSSSAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFL RTRNLIAPIFLHRTLTYMSHRNSRTNIKRKTFKVDDMLSKVEKMKGEQES HSLSAHLQLTFTGFFHKNDKPSPNSENEQNSVTLEVLLVKVCHKKRKDVS CPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSL LFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMT VFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFS QGPTLQFTLRWTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTI AVKESLTTDLQTRKEKDTPN ENRQKLRIFYQFLYNNNTRQQTEARDDL HCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGS YAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESED GEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTIT QIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKII KKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPAN EEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL
    • Molecular weight

      87 kDa including tags
    • Amino acids

      1 to 739
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NM_015355.

Specifications

Our Abpromise guarantee covers the use of ab198127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity

    > 95 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    Useful for Western blot analysis and to investigate protein-protein interactions in the EZH2 complex. Requires EED protein for methyltransferase activity.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.05% DTT, 0.49% Glutathione, 0.02% Potassium chloride, 20% Glycerol

Images

  • 10% SDS-PAGE analysis of ab198127 with Coomassie staining.

    Lane 1: 2.8µg ab198127 complex
    Lane 2: Protein marker

References

ab198127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up