Description

  • Product name

    Recombinant Human Ezrin protein
    See all Ezrin proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYV DNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQK LFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSE RLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEM YGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISF NDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLR LQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAK EELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAK EAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYS AELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHN DIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
    • Predicted molecular weight

      96 kDa including tags
    • Amino acids

      1 to 586

Specifications

Our Abpromise guarantee covers the use of ab132943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Villin 2 ezrin
    • CVIL
    • CVL
    • Cytovillin
    • Cytovillin 2
    • DKFZp762H157
    • Epididymis secretory protein Li 105
    • EZR
    • EZRI_HUMAN
    • Ezrin
    • FLJ26216
    • HEL S 105
    • MGC1584
    • p81
    • VIL 2
    • VIL2
    • Villin 2
    • Villin 2 (ezrin)
    • Villin-2
    • Villin2
    see all
  • Function

    Probably involved in connections of major cytoskeletal structures to the plasma membrane. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis.
  • Tissue specificity

    Expressed in cerebral cortex, basal ganglia, hippocampus, hypophysis, and optic nerve. Weakly expressed in brain stem and diencephalon. Stronger expression was detected in gray matter of frontal lobe compared to white matter (at protein level). Component of the microvilli of intestinal epithelial cells. Preferentially expressed in astrocytes of hippocampus, frontal cortex, thalamus, parahippocampal cortex, amygdala, insula, and corpus callosum. Not detected in neurons in most tissues studied.
  • Sequence similarities

    Contains 1 FERM domain.
  • Developmental stage

    Very strong staining is detected in the Purkinje cell layer and in part of the molecular layer of the infant brain compared to adult brain.
  • Post-translational
    modifications

    Phosphorylated by tyrosine-protein kinases.
  • Cellular localization

    Apical cell membrane. Cell projection. Cell projection > microvillus membrane. Cell projection > ruffle membrane. Cytoplasm > cell cortex. Cytoplasm > cytoskeleton. Localization to the apical membrane of parietal cells depends on the interaction with MPP5. Localizes to cell extensions and peripheral processes of astrocytes (By similarity). Microvillar peripheral membrane protein.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132943 stained with Coomassie Blue

References

ab132943 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up