Description

  • Product name

    Recombinant Human F-spondin protein
    See all F-spondin proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PQFGGAPCPETVQRKKCRIRKCLRNPSIQKLRWREARESRRSEQLKEESE GEQFPGCRMRPWTAWSECTKLCGGGIQERYMTVKKRFKSSQFTSCKDKKE IRACNVHP
    • Amino acids

      699 to 806
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160978 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SPON1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • F spondin
    • SPON 1
    • Spondin 1
    • spondin 1 (f spondin) extracellular matrix protein
    • Spondin 1 extracellular matrix protein
    • Spondin 1 precursor
    • Spondin1
    • Vascular smooth muscle cell growth promoting factor
    • VSGP
    • VSGP/F spondin
    see all
  • Relevance

    SPON1 is a member of a subgroup of the thrombospondin type 1 (TSR) class molecules, defined by two domains of homology, the FS1/FS2 and TSR domains. The TSRs of SPON1 proteins are typical of class 2 TSRs. SPON1, which is similar to thrombospondin, is a extracellular matrix attached molecule that promotes neurite outgrowth and inhibits angiogenesis. Analysis of gain and loss of function experiments reveal that SPON1 is required for accurate pathfinding of embryonic axons, and plays a dual role in patterning axonal trajectories. It promotes the outgrowth of commissural and inhibits the outgrowth of motor axons, and has also been implicated in inflammatory processes in the nervous system.
  • Cellular localization

    Secreted protein; extracellular space; extracellular matrix.

Images

  • ab160978 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160978 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160978.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up