Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGFNLLLFWGCCVMHSWEGHIRPTRKPNTKGNNCRDSTLCPAYATCTNT VDSYYCACKQGFLSSNGQNHFKDPGVRCKDIDECSQSPQPCGPNSSCKNL SGRYKCSCLDGFSSPTGNDWVPGKPGNFSCTDINECLTSSVCPEHSDCVN SMGSYSCSCQVGFISRNSTCEDVDECADPRACPEHATCNNTVGNYSCFCN PGFESSSGHLSFQGLKASCEDIDECTEMCPINSTCTNTPGSYFCTCHPGF APSNGQLNFTDQGVECRDIDECRQDPSTCGPNSICTNALGSYSCGCIAGF HPNPEGSQKDGNFSCQRVLFKCKEDVIPDNKQIQQCQEGTAVKPAYVSFC AQINNIFSVLDKVCENKTTVVSLKNTTESFVPVLKQISTWTKFTKEETSS LATVFLESVESMTLASFWKPSANITPAVRTEYLDIESKVINKECSEENVT LDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVLNERFFKDHQA PLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPIC VSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAIIMASGELTMGC AIIAGFLHYLFLACFFWMLVEAVILFLMVRNLKVVNYFSSRNIKMLHICA FGYGLPMLVVVISASVQPQGYGMHNRCWLNTETGFIWSFLGPVCTVIVIN SLLLTWTLWILRQRLSSVNAEVSTLKDTRLLTFKAFAQLFILGCSWVLGI FQIGPVAGVMAYLFTIINSLQGAFIFLIHCLLNGQVREEYKRWITGKTKP SSQSQTSRILLSSMPSASKTG
    • Molecular weight
      117 kDa including tags
    • Amino acids
      1 to 821

Specifications

Our Abpromise guarantee covers the use of ab131740 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ADGRE1
    • Adhesion G protein coupled receptor E1
    • Adhesion G protein-coupled receptor E1
    • AGRE1_HUMAN
    • Cell surface glycoprotein EMR1
    • Cell surface glycoprotein F4/80
    • DD7A5 7
    • Egf like module containing mucin like hormone receptor like 1
    • Egf like module containing mucin like hormone receptor like sequence 1
    • EGF like module receptor 1
    • EGF TM7
    • EGF-like module receptor 1
    • EGF-like module-containing mucin-like hormone receptor-like 1
    • EGFTM7
    • EMR 1
    • EMR1 hormone receptor
    • Gpf480
    • Ly71
    • Lymphocyte antigen 71
    • TM7LN3
    see all
  • Function
    Orphan receptor involved in cell adhesion and probably in cell-cell interactions specifically involving cells of the immune system. May play a role in regulatory T-cells (Treg) development.
  • Tissue specificity
    Expression is restricted to eosinophils.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family. Adhesion G-protein coupled receptor (ADGR) subfamily.
    Contains 6 EGF-like domains.
    Contains 1 GPS domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131740, stained with Coomassie Blue.

References

ab131740 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131740.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up