Description

  • Product name

    Recombinant Human FAAH2 protein
    See all FAAH2 proteins and peptides
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAPSFTARIQLFLLRALGFLIGLVGRAALVLGGPKFASKTPRPVTEPLLL LSGMQLAKLIRQRKVKCIDVVQAYINRIKDVNPMINGIVKYRFEEAMKEA HAVDQKLAEKQEDEATLENKWPFLGVPLTVKEAFQLQGMPNSSGLMNRRD AIAKTDATVVALLKGAGAIPLGITNCSELCMWYESSNKIYGRSNNPYDLQ HIVGGSSGGEGCTLAAACSVIGVGSDIGGSIRMPAFFNGIFGHKPSPGVV PNKGQFPLAVGAQELFLCTGPMCRYAEDLAPMLKVMAGPGIKRLKLDTKV HLKDLKFYWMEHDGGSFLMSKVDQDLIMTQKKVVVHLETILGASVQHVKL KKMKYSFQLWIAMMSAKGHDGKEPVKFVDLLGDHGKHVSPLWELIKWCLG LSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKELVDMLGDDGVFL YPSHPTVAPKHHVPLTRPFNFAYTGVFSALGLPVTQCPLGLNAKGLPLGI QVVAGPFNDHLTLAVAQYLEKTFGGWVCPGKF
    • Amino acids

      1 to 532
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165703 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AMDD
    • amidase domain containing
    • amidase domain containing protein
    • Amidase domain-containing protein
    • Anandamide amidohydrolase 2
    • FAAH-2
    • FAAH2
    • FAAH2_HUMAN
    • fatty acid amide hydrolase 2
    • Fatty-acid amide hydrolase 2
    • FLJ31204
    • Oleamide hydrolase 2
    • RP11-479E16
    • RP11-479E16.1
    see all
  • Function

    Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes monounsaturated substrate anandamide preferentially as compared to polyunsaturated substrates.
  • Tissue specificity

    Highly expressed in the brain, small intestine and testis. Also expressed in the heart, kidney, liver, lung and prostate.
  • Sequence similarities

    Belongs to the amidase family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab165703 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165703 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165703.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up