Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGM FCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK
    • Molecular weight
      37 kDa
    • Amino acids
      331 to 430

Specifications

Our Abpromise guarantee covers the use of ab170592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes

    Previously labelled as GOT2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AATM_HUMAN
    • AL022787
    • Aspartate aminotransferase
    • Aspartate aminotransferase 2
    • Aspartate aminotransferase, mitochondrial
    • Aspartate transaminase 2
    • ASPATA
    • EC 2.6.1.1
    • FABP 1
    • FABP pm
    • FABP-1
    • FABPpm
    • Fatty acid binding protein
    • Fatty acid-binding protein
    • FLJ40994
    • Glutamate oxaloacetate transaminase 2
    • Glutamate oxaloacetate transaminase 2, mitochondrial
    • Glutamate oxaloacetate transaminase, mitochondrial
    • Glutamic oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
    • Got 2
    • GOT2
    • KAT4
    • KATIV
    • kynurenine aminotransferase 4
    • Kynurenine aminotransferase IV
    • kynurenine--oxoglutarate transaminase 4
    • kynurenine--oxoglutarate transaminase IV
    • mAspAT
    • MGC102129
    • MGC115763
    • mitAAT
    • mitochondrial
    • Mitochondrial aspartate aminotransferase
    • OTTMUSP00000017748
    • Plasma membrane fatty acid binding protein
    • Plasma membrane-associated fatty acid-binding protein
    • Transaminase A
    see all
  • Function
    Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids.
  • Sequence similarities
    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization
    Mitochondrion matrix. Cell membrane. Exposure to alcohol promotes translocation to the cell membrane.
  • Information by UniProt

References

ab170592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab170592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up