Description

  • Product name

    Recombinant human FABP-1 protein
    See all FABP-1 proteins and peptides
  • Biological activity

    Specific activity is > 60 units/mg, and is defined as the amount of enzyme that convert 1μmole of α-ketoglutarate to L-Glutamate per
    minute at pH 8.0 at 25°C.

  • Purity

    > 95 % SDS-PAGE.
    ab206788 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSSSWWTHVEMGPPDPILGVTEAFKRDTN SKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFC KASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVF LPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSV LLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDK DAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVES QLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRT QLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDG RISVAGVTSSNVGYLAHAIHQVTK
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      30 to 430
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is for the mature full length protein. The transit peptide is not included. NP_002071.

Specifications

Our Abpromise guarantee covers the use of ab206788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

    Previously labelled as GOT2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 10% Glycerol, 0.32% Tris HCl, 0.87% Sodium chloride, 0.02% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AATM_HUMAN
    • AL022787
    • Aspartate aminotransferase
    • Aspartate aminotransferase 2
    • Aspartate aminotransferase, mitochondrial
    • Aspartate transaminase 2
    • ASPATA
    • EC 2.6.1.1
    • FABP 1
    • FABP pm
    • FABP-1
    • FABPpm
    • Fatty acid binding protein
    • Fatty acid-binding protein
    • FLJ40994
    • Glutamate oxaloacetate transaminase 2
    • Glutamate oxaloacetate transaminase 2, mitochondrial
    • Glutamate oxaloacetate transaminase, mitochondrial
    • Glutamic oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
    • Got 2
    • GOT2
    • KAT4
    • KATIV
    • kynurenine aminotransferase 4
    • Kynurenine aminotransferase IV
    • kynurenine--oxoglutarate transaminase 4
    • kynurenine--oxoglutarate transaminase IV
    • mAspAT
    • MGC102129
    • MGC115763
    • mitAAT
    • mitochondrial
    • Mitochondrial aspartate aminotransferase
    • OTTMUSP00000017748
    • Plasma membrane fatty acid binding protein
    • Plasma membrane-associated fatty acid-binding protein
    • Transaminase A
    see all
  • Function

    Plays a key role in amino acid metabolism. Important for metabolite exchange between mitochondria and cytosol. Facilitates cellular uptake of long-chain free fatty acids.
  • Sequence similarities

    Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family.
  • Cellular localization

    Mitochondrion matrix. Cell membrane. Exposure to alcohol promotes translocation to the cell membrane.
  • Information by UniProt

Images

  • Anti-FABP-1 antibody [EPR12354(B)] (ab171739) at 1/1000 dilution + Recombinant human FABP-1 protein (ab206788) at 0.015 µg with 5% NFDM/TBST

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/20000 dilution

    Observed band size: 47 kDa
    why is the actual band size different from the predicted?


    Exposure time: 10 seconds
  • Anti-Aspartate Aminotransferase + FABP-1 antibody [EPR12145] (ab170950) at 1/1000 dilution + Recombinant human FABP-1 protein (ab206788) at 0.015 µg

    Secondary
    Goat Anti-Rabbit IgG H&L (HRP) (ab97051) at 1/20000 dilution

    Exposure time: 180 seconds
  • 15% SDS-PAGE analysis of ab206788 (3μg).

References

ab206788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up