Description

  • Product name

    Recombinant Human FABP5 protein
    See all FABP5 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKN LTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWD GKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
    • Predicted molecular weight

      16 kDa including tags
    • Amino acids

      2 to 135
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (AAH19385)

Specifications

Our Abpromise guarantee covers the use of ab179986 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Fatty Acid Binding Protein 5

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Upon reconsitution add a carrier protein (0.1% BSA). Store at +4°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

  • Reconstitution
    It is recommended to reconstitute the lyophilized protien in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.

General Info

  • Alternative names

    • CFABP
    • Cutaneous fatty acid binding protein
    • DA11
    • Differentiation associated lipid binding protein LP2
    • E-FABP
    • EFABP
    • Epidermal-type fatty acid-binding protein
    • FABP5
    • FABP5_HUMAN
    • fatty acid binding protein 5 (psoriasis-associated)
    • Fatty acid binding protein epidermal
    • Fatty acid-binding protein 5
    • Fatty acid-binding protein, epidermal
    • Keratinocyte lipid binding protein
    • KFABP
    • Klbp
    • mal1
    • PA-FABP
    • PAFABP
    • Psoriasis associated fatty acid binding protein homolog
    • Psoriasis-associated fatty acid-binding protein homolog
    see all
  • Function

    High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.
  • Tissue specificity

    Keratinocytes; highly expressed in psoriatic skin.
  • Sequence similarities

    Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
  • Domain

    Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab179986 in reducing conditions. Gel stained overnight with Coomassie Blue.

References

ab179986 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179986.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up