Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMILGGREAEAHARPYMASVQLNGAHLCGGV LVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHP DSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWG IVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSC KGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
    • Molecular weight

      27 kDa including tags
    • Amino acids

      26 to 253
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Factor D

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • Adipsin
    • Adipsin/complement factor D
    • Adn
    • C3 convertase activator
    • CFAD_HUMAN
    • CFD
    • Complement factor D
    • complement factor D preproprotein
    • D component of complement
    • DF
    • FactorD
    • PFD
    • Properdin factor D
    see all
  • Function

    Factor D cleaves factor B when the latter is complexed with factor C3b, activating the C3bbb complex, which then becomes the C3 convertase of the alternate pathway. Its function is homologous to that of C1s in the classical pathway.
  • Involvement in disease

    Defects in CFD are the cause of complement factor D deficiency (CFD deficiency) [MIM:134350]. CFD deficiency predisposes to invasive meningococcal disease.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139231.

References

ab139231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up