Overview

  • Product name

    Recombinant Human FADS1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTR RHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPSF EPTKNKELTDEFRELRATVERMGLMKANHVFFLLYLLHILLLDGAAWLTL WVFGTSFLPFLLCAVLLSAVQAQAGWLQHDFGHLSVFSTSKWNHLLHHFV IGHLKGAPASWWNHMHFQHHAKPNCFRKDPDINMHPFFFALGKILSVELG KQKKKYMPYNHQHKYFFLIGPSALLPLYFQWYIFYFVIQRKKWVDLAWMI TFYVRFFLTYVPLLGLKAFLGLFFIVRFLESNWFVWVTQMNHIPMHIDHD RNMDWVSTQLQATCNVHKSAFNDWFSGHLNFQIEHHLFPTMPRHNYHKVA PLVQSLCAKHGIEYQSKPLLSAFADIIHSLKESGQLWLDAYLHQ
    • Molecular weight

      74 kDa including tags
    • Amino acids

      1 to 444

Specifications

Our Abpromise guarantee covers the use of ab152502 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • D5D
    • Delta 5 desaturase
    • Delta 5 fatty acid desaturase
    • Delta(5) desaturase
    • Delta(5) fatty acid desaturase
    • Delta-5 desaturase
    • Fads1
    • FADS1_HUMAN
    • FADS6
    • FADSD5
    • Fatty acid desaturase 1
    • FLJ38956
    • Linoleoyl CoA desaturase (delta 6 desaturase) like 1
    • LLCDL1
    • TU12
    see all
  • Function

    Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the desaturation of dihomo-gamma-linoleic acid (DHGLA) (20:3n-6) and eicosatetraenoic acid (20:4n-3) to generate arachidonic acid (AA) (20:4n-6) and eicosapentaenoic acid (EPA)(20:5n-3) respectively.
  • Tissue specificity

    Expressed in many tissues, it is most abundant in the liver, brain, adrenal gland and heart. Found as well in skeletal muscle, lung, placenta, kidney, pancreas and retina.
  • Pathway

    Lipid metabolism; polyunsaturated fatty acid biosynthesis.
  • Sequence similarities

    Belongs to the fatty acid desaturase family.
    Contains 1 cytochrome b5 heme-binding domain.
  • Developmental stage

    Highly expressed in fetal liver and fetal brain.
  • Domain

    The histidine box domains may contain the active site and/or be involved in metal ion binding.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152502 stained with Coomassie Blue.

References

ab152502 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152502.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up