Description

  • Product name

    Recombinant Human FAIM1 protein
    See all FAIM1 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG KETFYVGAAKTKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTNTW VLHMDGENFRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHDCY IKAVSSGKRKEGIIHTLIVDNREIPEIAS
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      1 to 179

Specifications

Our Abpromise guarantee covers the use of ab132652 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Faim
    • FAIM 1
    • FAIM1
    • FAIM1_HUMAN
    • Fas apoptotic inhibitory molecule
    • Fas apoptotic inhibitory molecule 1
    see all
  • Function

    Plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.
  • Sequence similarities

    Belongs to the FAIM1 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132652 stained with Coomassie Blue.

References

ab132652 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132652.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up