Overview

  • Product name
    Recombinant Human FAIM2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAG AFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRR VFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFA TYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLG ITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYV PWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDI IYIFTFFLQLFGTNRE
    • Amino acids
      1 to 316
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FAIM 2
    • Faim2
    • FAIM2_HUMAN
    • Fas apoptotic inhibitory molecule 2
    • KIAA0950
    • LFG
    • Lifeguard
    • Neural membrane protein 35
    • NGP 35
    • NGP35
    • NMP 35
    • NMP35
    • Protein lifeguard
    • TMBIM 2
    • TMBIM2
    • Transmembrane BAX inhibitor motif containing 2
    • Transmembrane BAX inhibitor motif containing protein 2
    • Transmembrane BAX inhibitor motif-containing protein 2
    see all
  • Function
    Protects cells uniquely from Fas-induced apoptosis.
  • Tissue specificity
    Widely expressed. Expressed at high levels in the brain especially in the hippocampus.
  • Sequence similarities
    Belongs to the BI1 family.
  • Cellular localization
    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Images

  • ab161504 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up