Overview

  • Product name

    Recombinant Human FAIM2/LFG protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAG AFPPAPTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRR VFVRKVYTILLIQLLVTLAVVALFTFCDPVKDYVQANPGWYWASYAVFFA TYLTLACCSGPRRHFPWNLILLTVFTLSMAYLTGMLSSYYNTTSVLLCLG ITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLILAILLPFQYV PWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDI IYIFTFFLQLFGTNRE
    • Amino acids

      1 to 316
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as FAIM2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FAIM 2
    • Faim2
    • FAIM2_HUMAN
    • Fas apoptotic inhibitory molecule 2
    • KIAA0950
    • LFG
    • Lifeguard
    • Neural membrane protein 35
    • NGP 35
    • NGP35
    • NMP 35
    • NMP35
    • Protein lifeguard
    • TMBIM 2
    • TMBIM2
    • Transmembrane BAX inhibitor motif containing 2
    • Transmembrane BAX inhibitor motif containing protein 2
    • Transmembrane BAX inhibitor motif-containing protein 2
    see all
  • Function

    Protects cells uniquely from Fas-induced apoptosis.
  • Tissue specificity

    Widely expressed. Expressed at high levels in the brain especially in the hippocampus.
  • Sequence similarities

    Belongs to the BI1 family.
  • Cellular localization

    Cell membrane. Cell junction > synapse > postsynaptic cell membrane.
  • Information by UniProt

Images

  • ab161504 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up