Description

  • Product name

    Recombinant Human FAM171B protein (Fc Chimera)
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ELSRSDLSLIQQQQQQQQQQQQQQQQKQLEEAEEERTEVPGATSTLTVPV SVFMLKVQVNDIISRQYLSQAVVEVFVNYTKTNSTVTKSNGAVLIKVPYK LGLSLTIIAYKDGYVLTPLPWKTRRMPIYSSVTLSLFPQSQANIWLFEDT VLITGKLADAKSQPSVQFSKALIKLPDNHHISNVTGYLTVLQQFLKVDNF LHTTGITLNKPGFENIELTPLAAICVKIYSGGKELKVNGSIQVSLPLLRL NDISAGDRIPAWTFDMNTGAWINHGRGMVKEHNNHLIWTYDAPHLGYWIA APLPGTRGSGINEDSKDITAYHT
    • Predicted molecular weight

      63 kDa including tags
    • Amino acids

      33 to 355
    • Additional sequence information

      Extracellular domain fused with a human IgG1 Fc tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab219673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, Glycine, Sodium chloride, L-Arginine

    Lyophilized from 0.22 µm filtered solution. Normally trehalose is added as protectant before lyophilization.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • F171B_HUMAN
    • Fam171b
    • Family with sequence similarity 171, member B
    • KIAA1946
    • Protein FAM171B
    see all
  • Sequence similarities

    Belongs to the FAM171 family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab219673, stained overnight with Coomassie Blue.

    The reduced protein migrates as 80-95 kDa in SDS-PAGE due to glycosylation.

References

ab219673 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up