Overview

  • Product name
    Recombinant Human FAM175B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSYREQVLHKQLTRILGVPDLVFLLFSFISTANNSTHALEYVLFRPNRRY NQRISLAIPNLGNTSQQEYKVSSVPNTSQSYAKVIKEHGTDFFDKDGVMK DIRAIYQVYNALQEKVQAVCADVEKSERVVESCQAEVNKLRRQITQRKNE KEQERRLQQAVLSRQMPSESLDPAFSPRMPSSGFAAEGRSTLGDAEASDP PPPYSDFHPNNQESTLSHSRMERSVFMPRPQAVGSSNYASTSAGLKYPGS GADLPPPQRAAGDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPD EDPRNTQTSQI
    • Amino acids
      1 to 311
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161558 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AA589499
    • Abraxas brother 1
    • ABRO
    • ABRO 1
    • ABRO1
    • AI853413
    • C430003P19Rik
    • Em:AC068896.4
    • Family with sequence similarity 175, member B
    • FLJ22338
    • hypothetical protein LOC23172
    • KIAA0157
    • OTTHUMP00000020697
    • RGD1308918
    see all
  • Relevance
    FAM175B (ABRO1) is a 415 amino acid protein, sharing 39% identity to ABRA1 in the N terminal two thirds of the protein (amino acids 1 to 260), including a coiled-coil domain and a region called the ABR domain. However, ABRO1 lacks the phosphorylated ser-X-X-phe motif of ABRA1 and, unlike ABRA1, does not bind to BRCA1.

Images

  • ab161558 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161558 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161558.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up