Overview

  • Product name
    Recombinant Human FAM19A2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRA APSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVT H
    • Molecular weight
      11 kDa
    • Amino acids
      31 to 131

Specifications

Our Abpromise guarantee covers the use of ab54415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    Purity : Greater than 98% by SDS-PAGE gel and HPLC analyses. Endotoxin Level : < 0.1 ng per µg (1EU/µg).
  • Form
    Lyophilised
  • Additional notes

    Previously labelled as TAFA 2.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

General Info

  • Alternative names
    • Chemokine like protein TAFA 2
    • Chemokine-like protein TAFA-2
    • Chemokine-like protein TAFA2
    • DKFZp761E1217
    • DKFZp781P0552
    • F19A2_HUMAN
    • FAM19A2
    • family with sequence similarity 19 (chemokine (C-C motif)-like), member A2
    • MGC42403
    • Protein FAM19A2
    • TAFA 2
    • TAFA2
    see all
  • Tissue specificity
    Brain-specific.
  • Sequence similarities
    Belongs to the FAM19/TAFA family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab54415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab54415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up