Overview

  • Product name

    Recombinant Human FAM3C/ILEI protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMA SGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDM WGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSIT NLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQ KQDVDHHHHHH
    • Molecular weight

      23 kDa including tags
    • Amino acids

      25 to 227
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151637 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab151637 is greater than 95% pure as determined by SEC-HPLC and reducing SDS-PAGE. It is lyophilized from an 0.2 µm filtered solution.
  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as FAM3C

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS.
    It is not recommended to reconstitute to a concentration less than 100 µg/ml.

General Info

  • Alternative names

    • Fam3c
    • FAM3C_HUMAN
    • Family with sequence similarity 3 member C
    • GS3786
    • ILEI
    • Interleukin-like EMT inducer
    • Predicted osteoblast protein
    • Protein FAM3C
    see all
  • Function

    May be involved in retinal laminar formation. Promotes epithelial to mesenchymal transition.
  • Tissue specificity

    Present in most secretory epithelia (at protein level).
  • Sequence similarities

    Belongs to the FAM3 family.
  • Cellular localization

    Secreted. Cytoplasmic vesicle. Cytoplasmic in some cancer cells.
  • Information by UniProt

References

ab151637 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151637.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up