Overview

  • Product name
    Recombinant Human FAM46A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEGEGYFAMSEDELACSPYIPLGGDFGGGDFGGGDFGGGDFGGGGSFGG HCLDYCESPTAHCNVLNWEQVQRLDGILSETIPIHGRGNFPTLELQPSLI VKVVRRRLAEKRIGVRDVRLNGSAASHVLHQDSGLGYKDLDLIFCADLRG EGEFQTVKDVVLDCLLDFLPEGVNKEKITPLTLKEAYVQKMVKVCNDSDR WSLISLSNNSGKNVELKFVDSLRRQFEFSVDSFQIKLDSLLLFYECSENP MTETFHPTIIGESVYGDFQEAFDHLCNKIIATRNPEEIRGGGLLKYCNLL VRGFRPASDEIKTLQRYMCSRFFIDFSDIGEQQRKLESYLQNHFVGLEDR KYEYLMTLHGVVNESTVCLMGHERRQTLNLITMLAIRVLADQNVIPNVAN VTCYYQPAPYVADANFSNYYIAQVQPVFTCQQQTYSTWLPCN
    • Amino acids
      1 to 442
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C6orf37
    • Chromosome 6 open reading frame 37
    • D930050G01Rik
    • FA46A_HUMAN
    • FAM46A
    • Family with sequence similarity 46, member A
    • FLJ20037
    • FLJ31495
    • HBV X-transactivated gene 11 protein
    • HBV XAg-transactivated protein 11
    • Hypothetical protein LOC55603
    • OTTHUMP00000016782
    • Protein FAM46A
    • Retinal expressed gene C6orf37
    • RGD1311381
    • XTP11
    see all
  • Tissue specificity
    Widely expressed, with preferential expression observed in the retina compared to other ocular tissues.
  • Sequence similarities
    Belongs to the FAM46 family.
  • Information by UniProt

Images

  • ab163140 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up