Overview

  • Product name

    Recombinant Human FAM46D protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSEIRFTNLTWDQVITLDQVLDEVIPIHGKGNFPTMEVKPKDIIHVVKDQ LIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQVV KDAVLDCLLDFLPKDVKKEKLSPDIMKDAYVQKLVKVCNGHDCWSLISLS NNTGKNLELKFVSSLRRQFEFSVDSFQIVLDPMLDFYSDKNAKLTKESYP VVVAESMYGDFQEAMTHLQHKLICTRKPEEIRGGGLLKYCSLLVHGFKPA CMSEIKNLERYMCSRFFIDFPHIEEQQKKIESYLHNHFIGEGMTKYDYLM TLHGVVNESTVCLMSYERRQILHLITMMALKVLGELNILPNTQKVTCFYQ PAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGMS
    • Amino acids

      1 to 389
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165814 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cancer/testis antigen 112
    • CT1.26
    • CT112
    • FAM46D
    • Family with sequence similarity 46, member D
    • Hypothetical protein LOC169966
    • MGC26999
    • Protein FAM46D
    see all
  • Relevance

    The specific function of FAM46D is not yet known.

Images

  • ab165814 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165814 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165814.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up