Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      TTKKRKLGKNPDVDTSFLPDRDREEEENRLREELRQEWEAKQEKIKSEEI EITFSYWDGSGHRRTVKMRKGNTMQQFLQKALEILRKDFSELRSAGVEQL MYIKEDLIIPHHHSFYDFIVTKARGKSGPLFNFDVHDDVRLLSDATVEKD ESHAGKVVLRSWYEKNKHIFPASRWEPYDPEKKWDKYTIR
    • Molecular weight
      25 kDa including tags
    • Amino acids
      150 to 339
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156718 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • 9F
    • DXS9928E
    • FA50A_HUMAN
    • FAM 50A
    • fam50a
    • Family with sequence similarity 50 member A
    • HXC 26
    • HXC26
    • OTTHUMP00000061460
    • Protein FAM50A
    • Protein HXC 26
    • Protein HXC-26
    • Protein HXC26
    • Protein XAP 5
    • Protein XAP-5
    • Protein XAP5
    • XAP 5
    • XAP 5 protein
    • XAP5
    • XAP5 gene
    • XAP5 protein
    see all
  • Function
    May be a DNA-binding protein or transcriptional factor.
  • Tissue specificity
    Expressed in all tissues examined. Mostly abundant in fetal brain, liver and kidney; in the adult, high levels were also observed in heart, skeletal muscle, spleen, thymus, prostate and small intestine.
  • Sequence similarities
    Belongs to the FAM50 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis using ab156718 at 3ug.

References

ab156718 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156718.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up