Description

  • Product name

    Recombinant Human FAM54B protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSGMEATVTIPIWQNKPHGAARSVVRRIGTNLPLKPCARASFETLPNISD LCLRDVPPVPTLADIAWIAADEEETYARVRSDTRPLRHTWKPSPLIVMQR NASVPNLRGSEERLLALKKPALPALSRTTELQDELSHLRSQIAKIVAADA ASASLTPDFLSPGSSNVSSPLPCFGSSFHSTTSFVISDITEETEVEVPEL PSVPLLCSASPECCKPEHKAACSSSEEDDCVSLSKASSFADMMGILKDFH RMKQSQDLNRSLLKEEDPAVLISEVLRRKFALKEEDISRKGN
    • Amino acids

      1 to 292
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163359 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI480750
    • Family with sequence similarity 54, member B
    • Hypothetical protein LOC56181
    • Hypothetical protein LOC76824
    • HYST1888
    • MST116
    • MSTP116
    • OTTHUMP00000008511
    • OTTMUSP00000011986
    • OTTMUSP00000011987
    • OTTMUSP00000011988
    • OTTMUSP00000037166
    • Protein FAM54B
    • RGD1305453
    see all
  • Relevance

    FAM54B belongs to the MTFR1/FAM54 family. Its function is not yet known.

Images

  • ab163359 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163359 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163359.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up