Overview

  • Product name
    Recombinant Human FAM63A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEYHQPEDPAPGKAGTAEAVIPENHEVLAGPDEHPQDTDARDADGEARER EPADQALLPSQCGDNLESPLPEASSAPPGPTLGTLPEVETIRACSMPQEL PQSPRTRQPEPDFYCVKWIPWKGEQTPIITQSTNGPCPLLAIMNILFLQW KVKLPPQKEVITSDELMAHLGNCLLSIKPQEKSEGLQLNFQQNVDDAMTV LPKLATGLDVNVRFTGVSDFEYTPECSVFDLLGIPLYHGWLVDPQSPEAV RAVGKLSYNQLVERIITCKHSSDTNLVTEGLIAEQFLETTAAQLTYHGLC ELTAAAKEGELSVFFRNNHFSTMTKHKSHLYLLVTDQGFLQEEQVVWESL HNVDGDSCFCDSDFHLSHSLGKGPGAEGGSGSPEKQLQVDQDYLIALSLQ QQQPRGPLGLTDLELAQQLQQEEYQQQQAAQPVRMRTRVLSLQGRGATSG RPAGERRQRPKHESDCILL
    • Amino acids
      1 to 469
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163224 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deubiquitinating enzyme MINDY-1
    • FA63A_HUMAN
    • FAM 63A
    • FAM63A
    • Family with sequence similarity 63 member A
    • FLJ11280
    • FLJ43504
    • Hypothetical protein LOC55793
    • KIAA1390
    • Protein FAM63A
    • RP11 316M1.5
    • Ubiquitin carboxyl-terminal hydrolase MINDY-1
    see all
  • Function
    Hydrolase that can specifically remove 'Lys-48'-linked conjugated ubiquitin from proteins. Has exodeubiquitinase activity and has a preference for long polyubiquitin chains. May play a regulatory role at the level of protein turnover.
  • Sequence similarities
    Belongs to the peptidase MINDY family. FAM63 subfamily.
  • Information by UniProt

Images

  • ab163224 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163224 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163224.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up