Overview

  • Product name
    Recombinant Human FAM82A2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSRLGALGGARAGLGLLLGTAAGLGFLCLLYSQRWKRTQRHGRSQSLPNS LDYTQTSDPGRHVMLLRAVPGGAGDASVLPSLPREGQEKVLDRLDFVLTS LVALRREVEELRSSLRGLAGEIVGEVRCHMEENQRVARRRRFPFVRERSD STGSSSVYFTASSGATFTDAESEGGYTTANAESDNERDSDKESEDGEDEV SCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHR GDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSY ALDGKEEAEAALEKGDESADCHLWYAVLCGQLAEHESIQRRIQSGFSFKE HVDKAIALQPENPMAHFLLGRWCYQVSHLSWLEKKTATALLESPLSATVE DALQSFLKAEELQPGFSKAGRVYISKCYRELGKNSEARWWMKLALELPDV TKEDLAIQKDLEELEVILRD
    • Amino acids
      1 to 470
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cerebral protein 10
    • FAM82C
    • FAM82C, formerly
    • Family with sequence similarity 82 member C
    • Family with sequence similarity 82 member C, formerly
    • Family with sequence similarity 82, member A2
    • FLJ10579
    • hRMD 3
    • Microtubule associated protein
    • Protein FAM82A2
    • Protein FAM82C
    • Protein tyrosine phosphatase interacting protein 51
    • PTPIP51
    • Regulator of microtubule dynamics 3
    • Regulator of microtubule dynamics protein 3
    • RMD 3
    • RMD3
    • TCPTP interacting protein 51
    see all
  • Relevance
    FAM82A2, or family with sequence similarity 82, member C, may participate in differentiation and apoptosis of keratinocytes. Overexpression of FAM82A2 induces apoptosis.
  • Cellular localization
    Mitochondrion membrane; Single-pass membrane protein. Cytoplasm. Nucleus. Note=In interphase localizes in the cytoplasm, and during mitosis localizes to the spindle microtubules and spindle poles.

Images

  • ab163000 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up