Description

  • Product name

    Recombinant Human FAM89B protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNGLPSAEAPGGAGCALAGLPPLPRGLSGLLNASGGSWRELERVYSQRSR IHDELSRAARAPDGPRHAAGAANAGPAAGPRRPVNLDSALAALRKEMLWG LYESIQDYKHLCQDLSFCQDLSSSLHSDSSYPPDAGLSDDEEPPDASLPP DPPPLTVPQTHNARDQWLQDAFHISL
    • Amino acids

      1 to 176
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Family with sequence similarity 89 member B
    • Mammary tumor virus receptor 2
    • Mammary turmor virus receptor homolog 1
    • MMTVR
    • MMTVR2
    • MTVR1
    • Protein FAM89B
    see all
  • Relevance

    FAM89B (Family with sequence similarity 89 member B) belongs to the FAM89 family. There are two named isoforms.

Images

  • ab161723 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up