Description

  • Product name

    Recombinant Human FAM96B protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVGGGGVGGGLLENANPLIYQRSGERPVTAGEEDEQVPDSIDAREIFDLI RSINDPEHPLTLEELNVVEQVRVQVSDPESTVAVAFTPTIPHCSMATLIG LSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVAAALENTH LLEVVNQCLSARS
    • Amino acids

      1 to 163
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CGI 128
    • FAM96B
    • Family with sequence similarity 96, member B
    • HSPC118
    • Hypothetical protein LOC51647
    • MIP18
    • MIP18_HUMAN
    • Mitotic spindle-associated MMXD complex subunit MIP18
    • MSS19-interacting protein of 18 kDa
    • Protein FAM96B
    see all
  • Function

    Component of the cytosolic iron-sulfur protein assembly (CIA) complex, a multiprotein complex that mediates the incorporation of iron-sulfur cluster into extramitochondrial Fe/S proteins. As part of the mitotic spindle-associated MMXD complex it plays a role in chromosome segregation, probably by facilitating iron-sulfur cluster assembly into ERCC2/XPD.
  • Sequence similarities

    Belongs to the MIP18 family.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton > spindle.
  • Information by UniProt

Images

  • ab162621 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up