Description

  • Product name

    Recombinant Human FARP1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDT QEAFEVPMVSSSSFLKAIGSSWTGWVLRCSMKPKHHSHLIEKFGEDRILT HLTGSISYTNWAGSRSLAVTVTEELLNLF
    • Predicted molecular weight

      41 kDa including tags
    • Amino acids

      1 to 129

Specifications

Our Abpromise guarantee covers the use of ab132348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CDEP
    • Chondrocyte derived ezrin like protein
    • Chondrocyte-derived ezrin-like protein
    • FARP1
    • FARP1_HUMAN
    • FERM
    • FERM RhoGEF and pleckstrin domain containing protein 1
    • FERM RhoGEF (ARHGEF) and pleckstrin domain protein 1 (chondrocyte-derived)
    • FERM, ARHGEF, and pleckstrin domain protein 1
    • PH domain-containing family C member 2
    • Pleckstrin homology domain-containing family C member 2
    • PLEKHC2
    • PPP1R75
    • protein phosphatase 1, regulatory subunit 75
    • RhoGEF and pleckstrin domain-containing protein 1
    see all
  • Function

    May function as Rho-guanine nucleotide exchange factor.
  • Tissue specificity

    Detected in cAMP-treated chondrocytes, but not in untreated chondrocytes. Detected in fetal brain, heart and spleen, and in adult testis, kidney and lung.
  • Sequence similarities

    Contains 1 DH (DBL-homology) domain.
    Contains 1 FERM domain.
    Contains 2 PH domains.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132348 stained with Coomassie Blue.

References

ab132348 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132348.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up