Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADGQVAELLLRRLEASDGGLDSAELAAELGMEHQAVVGAVKSLQALGEV IEAELRSTKHWELTAEGEEIAREGSHEARVFRSIPPEGLAQSELMRLPSG KVGFSKAMSNKWIRVDKSAADGPRVFRVVDSMEDEVQRRLQLVRGGQAEK LGEKERSELRKRKLLAEVTLKTYWVSKGSAFSTSISKQETELSPEMISSG SWRDRPFKPYNFLAHGVLPDSGHLHPLLKVRSQFRQIFLEMGFTEMPTDN FIESSFWNFDALFQPQQHPARDQHDTFFLRDPAEALQLPMDYVQRVKRTH SQGGYGSQGYKYNWKLDEARKNLLRTHTTSASARALYRLAQKKPFTPVKY FSIDRVFRNETLDATHLAEFHQIEGVVADHGLTLGHLMGVLREFFTKLGI TQLRFKPAYNPYTEPSMEVFSYHQGLKKWVEVGNSGVFRPEMLLPMGLPE NVSVIAWGLSLERPTMIKYGINNIRELVGHKVNLQMVYDSPLCRLDAEPR PPPTQEAA
    • Amino acids
      1 to 508
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CML 33
    • CML33
    • FARS
    • FARSA
    • FARSL
    • FRSA
    • PheHA
    • Phenylalanine tRNA ligase 1 alpha cytoplasmic
    • Phenylalanine tRNA ligase alpha chain
    • Phenylalanine tRNA synthetase alpha subunit
    • Phenylalanine tRNA synthetase like alpha subunit
    • Phenylalanyl tRNA synthetase alpha chain
    • Phenylalanyl tRNA synthetase alpha subunit
    • Phenylalanyl tRNA synthetase like alpha subunit
    • PheRS
    see all
  • Relevance
    FARSLA (Phenylalanyl-tRNA synthetase alpha chain) is an aminoacyl-tRNA synthetase. These are a class of enzymes that charge tRNAs with their cognate amino acids. Cytoplasmic phenylalanine-tRNA synthetase is a heterodimer consisting of a catalytic alpha subunit, FARSLA, and a regulatory beta subunit, FARSLB. This protein has been shown to be expressed in a tumor-selective and cell cycle stage- and differentiation-dependent manner, the first member of the tRNA synthetase family shown to exhibit this type of regulated expression.
  • Cellular localization
    Cytoplasmic

Images

  • ab158419 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158419 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up