Description

  • Product name

    Recombinant human Fas Ligand protein
    See all Fas Ligand proteins and peptides
  • Biological activity

    Determined by its ability to induce cytotoxicity in Jurkat cells in the absence of any cross-linking. The ED50 for this effect is ≤ 10.0 ng/ml, corresponding to a specific activity of ≥ 1 x 105 units/mg.

  • Purity

    > 95 % SDS-PAGE.
    ab186673 purity was also assessed by HPLC.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HHHHHHHHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVK YKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMM EGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTF FGLYKL
    • Predicted molecular weight

      18 kDa including tags
    • Amino acids

      133 to 281
    • Tags

      His tag N-Terminus
    • Additional sequence information

      soluble Fas Ligand comprising the TNF homologous region

Specifications

Our Abpromise guarantee covers the use of ab186673 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.16% Sodium phosphate, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial prior to opening. Reconstitute in water to 0.1 -1.0 mg/ml.

General Info

  • Alternative names

    • ALPS1B
    • Apoptosis (APO 1) antigen ligand 1
    • Apoptosis antigen ligand
    • Apoptosis antigen ligand 1
    • APT1LG1
    • APTL
    • CD178
    • CD178 antigen
    • CD95 ligand
    • CD95-L
    • CD95L
    • CD95L protein
    • Fas antigen ligand
    • Fas L
    • Fas ligand
    • Fas ligand (TNF superfamily member 6)
    • FASL
    • Fasl Fas ligand (TNF superfamily member 6)
    • FASLG
    • Generalized lymphoproliferative disease
    • Gld
    • soluble form
    • TNFL6_HUMAN
    • TNFSF6
    • Tumor necrosis factor (ligand) superfamily member 6
    • Tumor necrosis factor ligand superfamily member 6
    see all
  • Function

    Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
  • Involvement in disease

    Defects in FASLG are the cause of autoimmune lymphoproliferative syndrome type 1B (ALPS1B) [MIM:601859]; also known as Canale-Smith syndrome (CSS). ALPS is a childhood syndrome involving hemolytic anemia and thrombocytopenia with massive lymphadenopathy and splenomegaly.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications

    N-glycosylated.
    The soluble form derives from the membrane form by proteolytic processing.
  • Cellular localization

    Cell membrane. Secreted. May be released into the extracellular fluid, probably by cleavage form the cell surface.
  • Information by UniProt

References

ab186673 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186673.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up