Description

  • Product name

    Recombinant Human Fas Ligand protein (denatured)
    See all Fas Ligand proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMQIGHPSPPPEKKELRKVAHLTGKSNSRSM PLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLS HKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLY VNVSELSLVNFEESQTFFGLYKL
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      130 to 281
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139255 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • ALPS1B
    • Apoptosis (APO 1) antigen ligand 1
    • Apoptosis antigen ligand
    • Apoptosis antigen ligand 1
    • APT1LG1
    • APTL
    • CD178
    • CD178 antigen
    • CD95 ligand
    • CD95-L
    • CD95L
    • CD95L protein
    • Fas antigen ligand
    • Fas L
    • Fas ligand
    • Fas ligand (TNF superfamily member 6)
    • FASL
    • Fasl Fas ligand (TNF superfamily member 6)
    • FASLG
    • Generalized lymphoproliferative disease
    • Gld
    • soluble form
    • TNFL6_HUMAN
    • TNFSF6
    • Tumor necrosis factor (ligand) superfamily member 6
    • Tumor necrosis factor ligand superfamily member 6
    see all
  • Function

    Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects.
  • Involvement in disease

    Defects in FASLG are the cause of autoimmune lymphoproliferative syndrome type 1B (ALPS1B) [MIM:601859]; also known as Canale-Smith syndrome (CSS). ALPS is a childhood syndrome involving hemolytic anemia and thrombocytopenia with massive lymphadenopathy and splenomegaly.
  • Sequence similarities

    Belongs to the tumor necrosis factor family.
  • Post-translational
    modifications

    N-glycosylated.
    The soluble form derives from the membrane form by proteolytic processing.
  • Cellular localization

    Cell membrane. Secreted. May be released into the extracellular fluid, probably by cleavage form the cell surface.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab139255 (3 µg) at approximately 19.6 kDa.

References

ab139255 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139255.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up